Lineage for d4hvfa_ (4hvf A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1407410Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 1407411Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 1407957Family d.22.1.0: automated matches [191400] (1 protein)
    not a true family
  6. 1407958Protein automated matches [190526] (17 species)
    not a true protein
  7. 1407987Species Branchiostoma lanceolatum [TaxId:7740] [227942] (4 PDB entries)
  8. 1407988Domain d4hvfa_: 4hvf A: [234704]
    automated match to d4hvfd_
    complexed with gol

Details for d4hvfa_

PDB Entry: 4hvf (more details), 1.7 Å

PDB Description: crystal structure of green fluorescent protein langfp(branchiostoma lanceolatum)
PDB Compounds: (A:) Green fluorescent protein blFP-Y6

SCOPe Domain Sequences for d4hvfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hvfa_ d.22.1.0 (A:) automated matches {Branchiostoma lanceolatum [TaxId: 7740]}
sllpathelhifgsinslefdlvgrgtgnpkegyeelhlkstksalqfspwilvpqigyg
fyqylpfpdgamspfqaamndgsgyqvhrtmqfedgatltgiyrytyegthikgefqvig
tgfpadgpvmtnsltaadwcvtkivypnentiidkfdwtytttsgkryqsnvrsnftfak
piaanilqkqpmfvfrktelkhsktelnfkewqtafsdvm

SCOPe Domain Coordinates for d4hvfa_:

Click to download the PDB-style file with coordinates for d4hvfa_.
(The format of our PDB-style files is described here.)

Timeline for d4hvfa_:

  • d4hvfa_ appears in periodic updates to SCOPe 2.03 starting on 2014-01-12
  • d4hvfa_ appears in SCOPe 2.04
  • d4hvfa_ appears in the current release, SCOPe 2.07, called d4hvfa1