SCOPe 2.03: Domain d4hv6a2: 4hv6 A:63-134

Lineage for d4hv6a2 (4hv6 A:63-134)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.76: Iron-dependent repressor protein, dimerization domain [47978] (1 superfamily)
   6 helices, homodimer of 3-helical domains

4. Superfamily a.76.1: Iron-dependent repressor protein, dimerization domain [47979] (1 family)
   automatically mapped to Pfam PF02742

5. Family a.76.1.1: Iron-dependent repressor protein, dimerization domain [47980] (4 proteins)

6. Protein automated matches [233398] (2 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:224308] [234701] (1 PDB entry)

8. Domain d4hv6a2: 4hv6 A:63-134 [234702]
   Other proteins in same PDB: d4hv6a1, d4hv6b1
   automated match to d1on2a2
   complexed with mg, mn; mutant

Details for d4hv6a2

PDB Entry: 4hv6, 2.3 Å

PDB Description: Structure of MNTR H77A mutant in apo- and mn-bound forms

PDB Compounds: (A:) Transcriptional regulator mntR

SCOPe Domain Sequences for d4hv6a2:

Sequence; same for both SEQRES and ATOM records:

>d4hv6a2 a.76.1.1 (A:63-134) automated matches {Bacillus subtilis [TaxId: 224308]}
tskgkkigkrlvyraelleqflriigvdeekiyndvegiehhlswnsidrigdlvqyfee
ddarkkdlksiq

Timeline for d4hv6a2:

• d4hv6a2 is new in SCOPe 2.03-stable
  
• d4hv6a2 appears in SCOPe 2.04
  
• d4hv6a2 appears in the current release, SCOPe 2.08