| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.76: Iron-dependent repressor protein, dimerization domain [47978] (1 superfamily) 6 helices, homodimer of 3-helical domains |
Superfamily a.76.1: Iron-dependent repressor protein, dimerization domain [47979] (2 families) ![]() automatically mapped to Pfam PF02742 |
| Family a.76.1.1: Iron-dependent repressor protein, dimerization domain [47980] (4 proteins) |
| Protein automated matches [233398] (2 species) not a true protein |
| Species Bacillus subtilis [TaxId:224308] [234701] (4 PDB entries) |
| Domain d4hv6a2: 4hv6 A:63-134 [234702] Other proteins in same PDB: d4hv6a1, d4hv6b1 automated match to d1on2a2 complexed with mg, mn; mutant |
PDB Entry: 4hv6 (more details), 2.3 Å
SCOPe Domain Sequences for d4hv6a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hv6a2 a.76.1.1 (A:63-134) automated matches {Bacillus subtilis [TaxId: 224308]}
tskgkkigkrlvyraelleqflriigvdeekiyndvegiehhlswnsidrigdlvqyfee
ddarkkdlksiq
Timeline for d4hv6a2: