SCOPe 2.03: Domain d4hv6a1: 4hv6 A:2-62

Lineage for d4hv6a1 (4hv6 A:2-62)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.24: Iron-dependent repressor protein [46882] (4 proteins)
   automatically mapped to Pfam PF01325

6. Protein automated matches [233395] (2 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:224308] [234698] (1 PDB entry)

8. Domain d4hv6a1: 4hv6 A:2-62 [234699]
   Other proteins in same PDB: d4hv6a2, d4hv6b2
   automated match to d1on1a1
   complexed with mg, mn; mutant

Details for d4hv6a1

PDB Entry: 4hv6, 2.3 Å

PDB Description: Structure of MNTR H77A mutant in apo- and mn-bound forms

PDB Compounds: (A:) Transcriptional regulator mntR

SCOPe Domain Sequences for d4hv6a1:

Sequence; same for both SEQRES and ATOM records:

>d4hv6a1 a.4.5.24 (A:2-62) automated matches {Bacillus subtilis [TaxId: 224308]}
ttpsmedyieqiymlieekgyarvsdiaealavhpssvtkmvqkldkdeyliyekyrglv
l

Timeline for d4hv6a1:

• d4hv6a1 is new in SCOPe 2.03-stable
  
• d4hv6a1 appears in SCOPe 2.04
  
• d4hv6a1 appears in the current release, SCOPe 2.08