| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
| Family a.4.5.24: Iron-dependent repressor protein [46882] (4 proteins) automatically mapped to Pfam PF01325 |
| Protein automated matches [233395] (2 species) not a true protein |
| Species Bacillus subtilis [TaxId:224308] [234698] (4 PDB entries) |
| Domain d4hv6a1: 4hv6 A:2-62 [234699] Other proteins in same PDB: d4hv6a2, d4hv6b2 automated match to d1on1a1 complexed with mg, mn; mutant |
PDB Entry: 4hv6 (more details), 2.3 Å
SCOPe Domain Sequences for d4hv6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hv6a1 a.4.5.24 (A:2-62) automated matches {Bacillus subtilis [TaxId: 224308]}
ttpsmedyieqiymlieekgyarvsdiaealavhpssvtkmvqkldkdeyliyekyrglv
l
Timeline for d4hv6a1: