Lineage for d4hoca_ (4hoc A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2133075Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2133076Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2133255Family c.68.1.6: glucose-1-phosphate thymidylyltransferase [53464] (4 protein domains)
    automatically mapped to Pfam PF00483
  6. 2133274Protein RmlA (RfbA) [53465] (5 species)
  7. 2133275Species Aneurinibacillus thermoaerophilus [TaxId:143495] [228438] (9 PDB entries)
  8. 2133286Domain d4hoca_: 4hoc A: [234681]
    automated match to d4ho9a_
    complexed with so4, ud1

Details for d4hoca_

PDB Entry: 4hoc (more details), 2.2 Å

PDB Description: crystal structure of glucose 1-phosphate thymidylyltransferase from aneurinibacillus thermoaerophilus complexed with udp-n- acetylglucosamine
PDB Compounds: (A:) glucose-1-phosphate thymidylyltransferase

SCOPe Domain Sequences for d4hoca_:

Sequence, based on SEQRES records: (download)

>d4hoca_ c.68.1.6 (A:) RmlA (RfbA) {Aneurinibacillus thermoaerophilus [TaxId: 143495]}
mkgiilsggsgtrlypltkvvskqllpvydkpmvyyplsvlmlagikdiliistpedtpr
feqllgggselgislsyavqsspdglaqafiigeefigddnvalvlgdnifyghgftell
qraanrksgatifgynvkdpqrfgvvefdekgkvisieekpeepkssyavtglyfydnrv
vdiaknitpsargeleitdvnkaylelgelhvellgrgfawldtgthesllqasqfieti
ekrqslkvacleeiayrmgyisreqliklaeplmkneygqylmnlahr

Sequence, based on observed residues (ATOM records): (download)

>d4hoca_ c.68.1.6 (A:) RmlA (RfbA) {Aneurinibacillus thermoaerophilus [TaxId: 143495]}
mkgiilsggsgtrlypltkvvskqllpvydkpmvyyplsvlmlagikdiliistpedtpr
feqllgggselgislsyavqsspdglaqafiigeefigddnvalvlgdnifyghgftell
qraanrksgatifgynvkdpqrfgvvefdekgkvisieekpeepkssyavtglyfydnrv
vdiaknitpsgeleitdvnkaylelgelhvellgrgfawldtgthesllqasqfietiek
rqslkvacleeiayrmgyisreqliklaeplmkneygqylmnlahr

SCOPe Domain Coordinates for d4hoca_:

Click to download the PDB-style file with coordinates for d4hoca_.
(The format of our PDB-style files is described here.)

Timeline for d4hoca_: