Lineage for d1vrh3_ (1vrh 3:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (10 proteins)
    the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2
    there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus)
  6. Protein Rhinovirus coat proteins [49670] (5 species)
  7. Species Human rhinovirus B 14 (HRV-14) [TaxId:12131] [49671] (36 PDB entries)
  8. Domain d1vrh3_: 1vrh 3: [23467]
    protein/RNA complex; complexed with sd8

Details for d1vrh3_

PDB Entry: 1vrh (more details), 3 Å

PDB Description: hrv14/sdz 880-061 complex
PDB Compounds: (3:) rhinovirus 14

SCOPe Domain Sequences for d1vrh3_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vrh3_ b.121.4.1 (3:) Rhinovirus coat proteins {Human rhinovirus B 14 (HRV-14) [TaxId: 12131]}
glptttlpgsgqflttddrqspsalpnyeptprihipgkvhnlleiiqvdtlipmnntht
kdevnsyliplnanrqneqvfgtnlfigdgvfkttllgeivqyythwsgslrfslmytgp
alssaklilaytppgargpqdrreamlgthvvwdiglqstivmtipwtsgvqfrytdpdt
ytsagflscwyqtslilppettgqvyllsfisacpdfklrlmkdtqtisqtvalte

SCOPe Domain Coordinates for d1vrh3_ are not available.

Timeline for d1vrh3_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1vrh.1, d1vrh.1, d1vrh1_