![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest |
![]() | Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) ![]() |
![]() | Family c.68.1.6: glucose-1-phosphate thymidylyltransferase [53464] (4 proteins) automatically mapped to Pfam PF00483 |
![]() | Protein RmlA (RfbA) [53465] (5 species) |
![]() | Species Aneurinibacillus thermoaerophilus [TaxId:143495] [228438] (9 PDB entries) |
![]() | Domain d4ho2a_: 4ho2 A: [234669] automated match to d4ho9a_ complexed with so4, thm |
PDB Entry: 4ho2 (more details), 1.84 Å
SCOPe Domain Sequences for d4ho2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ho2a_ c.68.1.6 (A:) RmlA (RfbA) {Aneurinibacillus thermoaerophilus [TaxId: 143495]} mkgiilsggsgtrlypltkvvskqllpvydkpmvyyplsvlmlagikdiliistpedtpr feqllgggselgislsyavqsspdglaqafiigeefigddnvalvlgdnifyghgftell qraanrksgatifgynvkdpqrfgvvefdekgkvisieekpeepkssyavtglyfydnrv vdiaknitpsargeleitdvnkaylelgelhvellgrgfawldtgthesllqasqfieti ekrqslkvacleeiayrmgyisreqliklaeplmkneygqylmnlahr
Timeline for d4ho2a_: