Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
Family c.1.11.2: D-glucarate dehydratase-like [51609] (15 proteins) |
Protein automated matches [226997] (13 species) not a true protein |
Species Pseudomonas putida [TaxId:303] [228631] (7 PDB entries) |
Domain d4hnca2: 4hnc A:133-359 [234665] Other proteins in same PDB: d4hnca1, d4hncb1 automated match to d4hncb2 complexed with 0ut, mg |
PDB Entry: 4hnc (more details), 1.89 Å
SCOPe Domain Sequences for d4hnca2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hnca2 c.1.11.2 (A:133-359) automated matches {Pseudomonas putida [TaxId: 303]} pvqaydshsldgvklateravtaaelgfravktcigypaldqdlavvrsirqavgddfgi mvdynqsldvpaaikrsqalqqegvtwieeptlqhdyeghqriqsklnvpvqmgenwlgp eemfkalsigasrlampdamkiggvtgwirasalaqqfgipmsshlfqeisahllaatpt ahwlerldlagsvieptltfeggnavipdlpgvgiiwrekeigkylv
Timeline for d4hnca2: