![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
![]() | Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) ![]() |
![]() | Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
![]() | Protein automated matches [226922] (55 species) not a true protein |
![]() | Species Pseudomonas putida [TaxId:303] [228629] (5 PDB entries) |
![]() | Domain d4hnca1: 4hnc A:3-132 [234664] Other proteins in same PDB: d4hnca2, d4hncb2 automated match to d4hncb1 complexed with 0ut, mg |
PDB Entry: 4hnc (more details), 1.89 Å
SCOPe Domain Sequences for d4hnca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hnca1 d.54.1.0 (A:3-132) automated matches {Pseudomonas putida [TaxId: 303]} evlitglrtravnvplaypvhtavgtvgtaplvlidlatsagvvghsylfaytpvalksl kqllddmaamivneplapvsleamlakrfslagytglirmaaagidmaawdalgkvhetp lvkllganar
Timeline for d4hnca1: