Lineage for d4hn8b1 (4hn8 B:8-154)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2191243Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2191244Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2191540Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2191541Protein automated matches [226922] (88 species)
    not a true protein
  7. 2192068Species Pseudomonas mendocina [TaxId:399739] [234658] (1 PDB entry)
  8. 2192070Domain d4hn8b1: 4hn8 B:8-154 [234662]
    Other proteins in same PDB: d4hn8a2, d4hn8b2, d4hn8c2, d4hn8d2, d4hn8e1, d4hn8f1, d4hn8g1, d4hn8h2
    automated match to d4it1d1
    complexed with gol

Details for d4hn8b1

PDB Entry: 4hn8 (more details), 2.2 Å

PDB Description: crystal structure of a putative d-glucarate dehydratase from pseudomonas mendocina ymp
PDB Compounds: (B:) d-glucarate dehydratase

SCOPe Domain Sequences for d4hn8b1:

Sequence, based on SEQRES records: (download)

>d4hn8b1 d.54.1.0 (B:8-154) automated matches {Pseudomonas mendocina [TaxId: 399739]}
stprivdmqvipvagrdsmllnlcgahapyftrnlvllkdnagrtgcgevpggegirqal
ercrervigqsvgrynrvlndlrqaiagpakgpqttqhqvtseaearvlaqpheinlrld
nvitaveaalldllgqhlevpvaellg

Sequence, based on observed residues (ATOM records): (download)

>d4hn8b1 d.54.1.0 (B:8-154) automated matches {Pseudomonas mendocina [TaxId: 399739]}
stprivdmqvipvagrdsmllnlcgahapyftrnlvllkdnagrtgcgevpggegirqal
ercrervigqsvgrynrvlndlrqaiarldnvitaveaalldllgqhlevpvaellg

SCOPe Domain Coordinates for d4hn8b1:

Click to download the PDB-style file with coordinates for d4hn8b1.
(The format of our PDB-style files is described here.)

Timeline for d4hn8b1: