![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
![]() | Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) ![]() |
![]() | Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
![]() | Protein automated matches [226922] (95 species) not a true protein |
![]() | Species Pseudomonas mendocina [TaxId:399739] [234658] (1 PDB entry) |
![]() | Domain d4hn8b1: 4hn8 B:8-154 [234662] Other proteins in same PDB: d4hn8a2, d4hn8b2, d4hn8c2, d4hn8d2, d4hn8e1, d4hn8f1, d4hn8g1, d4hn8h2 automated match to d4it1d1 complexed with gol |
PDB Entry: 4hn8 (more details), 2.2 Å
SCOPe Domain Sequences for d4hn8b1:
Sequence, based on SEQRES records: (download)
>d4hn8b1 d.54.1.0 (B:8-154) automated matches {Pseudomonas mendocina [TaxId: 399739]} stprivdmqvipvagrdsmllnlcgahapyftrnlvllkdnagrtgcgevpggegirqal ercrervigqsvgrynrvlndlrqaiagpakgpqttqhqvtseaearvlaqpheinlrld nvitaveaalldllgqhlevpvaellg
>d4hn8b1 d.54.1.0 (B:8-154) automated matches {Pseudomonas mendocina [TaxId: 399739]} stprivdmqvipvagrdsmllnlcgahapyftrnlvllkdnagrtgcgevpggegirqal ercrervigqsvgrynrvlndlrqaiarldnvitaveaalldllgqhlevpvaellg
Timeline for d4hn8b1: