Lineage for d4hn8a1 (4hn8 A:8-154)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947581Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2947582Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2947878Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2947879Protein automated matches [226922] (95 species)
    not a true protein
  7. 2948451Species Pseudomonas mendocina [TaxId:399739] [234658] (1 PDB entry)
  8. 2948452Domain d4hn8a1: 4hn8 A:8-154 [234659]
    Other proteins in same PDB: d4hn8a2, d4hn8b2, d4hn8c2, d4hn8d2, d4hn8e1, d4hn8f1, d4hn8g1, d4hn8h2
    automated match to d4it1d1
    complexed with gol

Details for d4hn8a1

PDB Entry: 4hn8 (more details), 2.2 Å

PDB Description: crystal structure of a putative d-glucarate dehydratase from pseudomonas mendocina ymp
PDB Compounds: (A:) d-glucarate dehydratase

SCOPe Domain Sequences for d4hn8a1:

Sequence, based on SEQRES records: (download)

>d4hn8a1 d.54.1.0 (A:8-154) automated matches {Pseudomonas mendocina [TaxId: 399739]}
stprivdmqvipvagrdsmllnlcgahapyftrnlvllkdnagrtgcgevpggegirqal
ercrervigqsvgrynrvlndlrqaiagpakgpqttqhqvtseaearvlaqpheinlrld
nvitaveaalldllgqhlevpvaellg

Sequence, based on observed residues (ATOM records): (download)

>d4hn8a1 d.54.1.0 (A:8-154) automated matches {Pseudomonas mendocina [TaxId: 399739]}
stprivdmqvipvagrdsmllnlcgahapyftrnlvllkdnagrtgcgevpggegirqal
ercrervigqsvgrynrvlndlrqaialrldnvitaveaalldllgqhlevpvaellg

SCOPe Domain Coordinates for d4hn8a1:

Click to download the PDB-style file with coordinates for d4hn8a1.
(The format of our PDB-style files is described here.)

Timeline for d4hn8a1: