SCOPe 2.06: Domain d4hi8a_: 4hi8 A:

Lineage for d4hi8a_ (4hi8 A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
   multiple repeats of beta(2)-alpha(2) motif

4. Superfamily d.211.1: Ankyrin repeat [48403] (2 families)
   repeats organized in elongated structures

5. Family d.211.1.0: automated matches [191667] (1 protein)
   not a true family

6. Protein automated matches [191267] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189837] (20 PDB entries)

8. Domain d4hi8a_: 4hi8 A: [234651]
   automated match to d4hi9a_
   complexed with po4, zn

Details for d4hi8a_

PDB Entry: 4hi8, 1.2 Å

PDB Description: structure of integrin-linked kinase ankyrin repeat domain in complex with pinch1 lim1 domain collected at high energy, wavelength 0.32800

PDB Compounds: (A:) Integrin-linked protein kinase

SCOPe Domain Sequences for d4hi8a_:

Sequence; same for both SEQRES and ATOM records:

>d4hi8a_ d.211.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ddiftqcregnavavrlwldntendlnqgddhgfsplhwacregrsavvemlimrgarin
vmnrgddtplhlaashghrdivqkllqykadinavnehgnvplhyacfwgqdqvaedlva
ngalvsicnkygempvdkakaplrellreraekmgqnlnripykdtfwkg

Timeline for d4hi8a_:

• d4hi8a_ first appeared in SCOPe 2.03
  
• d4hi8a_ appears in SCOPe 2.05
  
• d4hi8a_ appears in SCOPe 2.07
  
• d4hi8a_ appears in the current release, SCOPe 2.08