![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein automated matches [190374] (15 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries) |
![]() | Domain d4hh9a2: 4hh9 A:108-214 [234650] Other proteins in same PDB: d4hh9a1, d4hh9b_, d4hh9c1, d4hh9d_ automated match to d4hh9c2 |
PDB Entry: 4hh9 (more details), 1.7 Å
SCOPe Domain Sequences for d4hh9a2:
Sequence, based on SEQRES records: (download)
>d4hh9a2 b.1.1.2 (A:108-214) automated matches {Human (Homo sapiens) [TaxId: 9606]} rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec
>d4hh9a2 b.1.1.2 (A:108-214) automated matches {Human (Homo sapiens) [TaxId: 9606]} rtvaapsvfifppsdeqlkgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqds kdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec
Timeline for d4hh9a2:
![]() Domains from other chains: (mouse over for more information) d4hh9b_, d4hh9c1, d4hh9c2, d4hh9d_ |