SCOPe 2.08: Domain d4heua_: 4heu A:

Lineage for d4heua_ (4heu A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families)

5. Family a.211.1.0: automated matches [191566] (1 protein)
   not a true family

6. Protein automated matches [190983] (12 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188676] (139 PDB entries)

8. Domain d4heua_: 4heu A: [234645]
   automated match to d3wi2a_
   complexed with 15j, so4, zn

Details for d4heua_

PDB Entry: 4heu, 2 Å

PDB Description: Crystal Structure of PDE10A with a biaryl ether inhibitor ((1-(3-(4-((1H-benzo[d]imidazol-2-yl)amino)phenoxy)pyridin-2-yl)piperidin-4-yl)methanol)

PDB Compounds: (A:) cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A

SCOPe Domain Sequences for d4heua_:

Sequence; same for both SEQRES and ATOM records:

>d4heua_ a.211.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tseewqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfeleklcrf
imsvkknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdldhrgfs
nsylqkfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleiirkaii
atdlalyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtkltand
iyaefwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilpptepl
lkacrdnlsqwekvirge

Timeline for d4heua_:

• d4heua_ first appeared in SCOPe 2.03
  
• d4heua_ appears in SCOPe 2.07