Lineage for d4hema1 (4hem A:63-163)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2776827Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
    sandwich, 10 strands in 2 sheets; greek-key
  4. 2776828Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) (S)
  5. 2777048Family b.21.1.3: Lactophage receptor-binding protein head domain [141122] (3 proteins)
    automatically mapped to Pfam PF08932
  6. 2777065Protein automated matches [232461] (1 species)
    not a true protein
  7. 2777066Species Lactococcus phage [TaxId:35345] [232462] (6 PDB entries)
  8. 2777068Domain d4hema1: 4hem A:63-163 [234644]
    Other proteins in same PDB: d4heme_, d4hemf_, d4hemg_
    automated match to d2f0ca1

Details for d4hema1

PDB Entry: 4hem (more details), 1.65 Å

PDB Description: llama vhh-02 binder of orf49 (rbp) from lactococcal phage tp901-1
PDB Compounds: (A:) bpp

SCOPe Domain Sequences for d4hema1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hema1 b.21.1.3 (A:63-163) automated matches {Lactococcus phage [TaxId: 35345]}
ptkswsgelgggiilslrkkgttveysiggeisssilansnlvnrsvpnefcprnrcslv
ghmvggwnafhidipssgvcqwfgptassgtprgtgtypid

SCOPe Domain Coordinates for d4hema1:

Click to download the PDB-style file with coordinates for d4hema1.
(The format of our PDB-style files is described here.)

Timeline for d4hema1: