Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
Protein Tyrosine-protein kinase Itk/Tsk [111194] (1 species) PTK group; Tec/Atk subfamily; non-membrane spanning protein tyrosine kinase |
Species Human (Homo sapiens) [TaxId:9606] [111195] (33 PDB entries) Uniprot Q08881 357-619 |
Domain d4hcta_: 4hct A: [234642] automated match to d4hcua_ complexed with 18r |
PDB Entry: 4hct (more details), 1.48 Å
SCOPe Domain Sequences for d4hcta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hcta_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} gkwvidpseltfvqeigsgqfglvhlgywlnkdkvaiktiregamseedfieeaevmmkl shpklvqlygvcleqapiclvfefmehgclsdylrtqrglfaaetllgmcldvcegmayl eeacvihrdlaarnclvgenqvikvsdfgmtrfvlddqytsstgtkfpvkwaspevfsfs ryssksdvwsfgvlmwevfsegkipyenrsnsevvedistgfrlykprlasthvyqimnh cwrerpedrpafsrllrqlaeiaes
Timeline for d4hcta_: