SCOPe 2.03: Domain d4hcpb_: 4hcp B:

Lineage for d4hcpb_ (4hcp B:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (9 families)

5. Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
   Pfam PF00240

6. Protein automated matches [190118] (8 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189560] (36 PDB entries)

8. Domain d4hcpb_: 4hcp B: [234640]
   automated match to d2bkrb_
   complexed with gol, so4

Details for d4hcpb_

PDB Entry: 4hcp, 2.52 Å

PDB Description: crystal structure of Burkholderia pseudomallei effector protein chbp in complex with nedd8

PDB Compounds: (B:) nedd8

SCOPe Domain Sequences for d4hcpb_:

Sequence; same for both SEQRES and ATOM records:

>d4hcpb_ d.15.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aamlikvktltgkeieidieptdkverikerveekegippqqqrliysgkqmndektaad
ykilggsvlhlvlal

Timeline for d4hcpb_:

• d4hcpb_ is new in SCOPe 2.03-stable
  
• d4hcpb_ appears in SCOPe 2.04
  
• d4hcpb_ appears in the current release, SCOPe 2.08, called d4hcpb1