SCOPe 2.05: Domain d4hafb2: 4haf B:342-444

Lineage for d4hafb2 (4haf B:342-444)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries)

8. Domain d4hafb2: 4haf B:342-444 [234635]
   automated match to d1igtb4

Details for d4hafb2

PDB Entry: 4haf, 2.04 Å

PDB Description: crystal structure of fc-fragment of human igg2 antibody (primitive crystal form)

PDB Compounds: (B:) Ig gamma-2 chain C region

SCOPe Domain Sequences for d4hafb2:

Sequence; same for both SEQRES and ATOM records:

>d4hafb2 b.1.1.0 (B:342-444) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qprepqvytlppsreemtknqvsltclvkgfypsdiavewesngqpennykttppmldsd
gsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslsls

Timeline for d4hafb2:

• d4hafb2 first appeared in SCOPe 2.03
  
• d4hafb2 appears in SCOPe 2.04
  
• d4hafb2 appears in SCOPe 2.06
  
• d4hafb2 appears in the current release, SCOPe 2.08