Lineage for d4h88a_ (4h88 A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1400466Fold d.6: Prion-like [54097] (1 superfamily)
    beta-alpha-beta-alpha(2); antiparallel beta-ribbon
  4. 1400467Superfamily d.6.1: Prion-like [54098] (1 family) (S)
  5. 1400468Family d.6.1.1: Prion-like [54099] (3 proteins)
  6. 1400529Protein automated matches [191016] (3 species)
    not a true protein
  7. 1400535Species Mus musculus [TaxId:10090] [234629] (1 PDB entry)
  8. 1400536Domain d4h88a_: 4h88 A: [234630]
    automated match to d1xyxa_
    complexed with na

Details for d4h88a_

PDB Entry: 4h88 (more details), 1.9 Å

PDB Description: Structure of POM1 FAB fragment complexed with mouse PrPc Fragment 120-230
PDB Compounds: (A:) major prion protein

SCOPe Domain Sequences for d4h88a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4h88a_ d.6.1.1 (A:) automated matches {Mus musculus [TaxId: 10090]}
lggymlgsamsrpmihfgndwedryyrenmyrypnqvyyrpvdqysnqnnfvhdcvniti
kqhtvvtttkgenftetdvkmmervveqmcvtqyqkesqayy

SCOPe Domain Coordinates for d4h88a_:

Click to download the PDB-style file with coordinates for d4h88a_.
(The format of our PDB-style files is described here.)

Timeline for d4h88a_: