![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.6: Prion-like [54097] (1 superfamily) beta-alpha-beta-alpha(2); antiparallel beta-ribbon |
![]() | Superfamily d.6.1: Prion-like [54098] (1 family) ![]() |
![]() | Family d.6.1.1: Prion-like [54099] (3 proteins) |
![]() | Protein automated matches [191016] (9 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [234629] (13 PDB entries) |
![]() | Domain d4h88a_: 4h88 A: [234630] Other proteins in same PDB: d4h88l1, d4h88l2 automated match to d1xyxa_ complexed with na |
PDB Entry: 4h88 (more details), 1.9 Å
SCOPe Domain Sequences for d4h88a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4h88a_ d.6.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} lggymlgsamsrpmihfgndwedryyrenmyrypnqvyyrpvdqysnqnnfvhdcvniti kqhtvvtttkgenftetdvkmmervveqmcvtqyqkesqayy
Timeline for d4h88a_: