Lineage for d4h88a_ (4h88 A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2498997Fold d.6: Prion-like [54097] (1 superfamily)
    beta-alpha-beta-alpha(2); antiparallel beta-ribbon
  4. 2498998Superfamily d.6.1: Prion-like [54098] (1 family) (S)
  5. 2498999Family d.6.1.1: Prion-like [54099] (3 proteins)
  6. 2499063Protein automated matches [191016] (9 species)
    not a true protein
  7. 2499083Species Mouse (Mus musculus) [TaxId:10090] [234629] (15 PDB entries)
  8. 2499084Domain d4h88a_: 4h88 A: [234630]
    Other proteins in same PDB: d4h88l1, d4h88l2
    automated match to d1xyxa_
    complexed with na

Details for d4h88a_

PDB Entry: 4h88 (more details), 1.9 Å

PDB Description: Structure of POM1 FAB fragment complexed with mouse PrPc Fragment 120-230
PDB Compounds: (A:) major prion protein

SCOPe Domain Sequences for d4h88a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4h88a_ d.6.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
lggymlgsamsrpmihfgndwedryyrenmyrypnqvyyrpvdqysnqnnfvhdcvniti
kqhtvvtttkgenftetdvkmmervveqmcvtqyqkesqayy

SCOPe Domain Coordinates for d4h88a_:

Click to download the PDB-style file with coordinates for d4h88a_.
(The format of our PDB-style files is described here.)

Timeline for d4h88a_: