Lineage for d4h26b1 (4h26 B:3-92)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1897191Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1897192Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 1897193Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1898109Protein automated matches [191280] (3 species)
    not a true protein
  7. 1898116Species Human (Homo sapiens) [TaxId:9606] [189896] (24 PDB entries)
  8. 1898140Domain d4h26b1: 4h26 B:3-92 [234614]
    Other proteins in same PDB: d4h26a1, d4h26a2, d4h26b2, d4h26d1, d4h26d2, d4h26e2
    automated match to d4h26e1

Details for d4h26b1

PDB Entry: 4h26 (more details), 2.5 Å

PDB Description: TCR interaction with peptide mimics of nickel offers structure insight to nickel contact allergy
PDB Compounds: (B:) MHC class II antigen

SCOPe Domain Sequences for d4h26b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4h26b1 d.19.1.1 (B:3-92) automated matches {Human (Homo sapiens) [TaxId: 9606]}
trprflellksechffngtervrfleryfhnqeefvrfdsdvgeyravtelgrpvaeswn
sqkdlleqkrgqvdtycrhnygvvesftvq

SCOPe Domain Coordinates for d4h26b1:

Click to download the PDB-style file with coordinates for d4h26b1.
(The format of our PDB-style files is described here.)

Timeline for d4h26b1: