Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (12 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (293 PDB entries) |
Domain d4h25e2: 4h25 E:93-190 [234613] Other proteins in same PDB: d4h25a1, d4h25a2, d4h25b1, d4h25d1, d4h25d2, d4h25e1 automated match to d4h26e2 complexed with ipa |
PDB Entry: 4h25 (more details), 2.2 Å
SCOPe Domain Sequences for d4h25e2:
Sequence, based on SEQRES records: (download)
>d4h25e2 b.1.1.2 (E:93-190) automated matches {Human (Homo sapiens) [TaxId: 9606]} rrvhpqvtvypaktqplqhhnllvcsvsgfypgsievrwfrngqeektgvvstglihngd wtfqtlvmletvprsgevytcqvehpsvtspltvewra
>d4h25e2 b.1.1.2 (E:93-190) automated matches {Human (Homo sapiens) [TaxId: 9606]} rrvhpqvtvypaktnllvcsvsgfypgsievrwfrngqeektgvvstglihngdwtfqtl vmletvprsgevytcqvehpsvtspltvewra
Timeline for d4h25e2: