Lineage for d4h25e2 (4h25 E:93-190)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1290587Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1294263Protein automated matches [190374] (12 species)
    not a true protein
  7. 1294295Species Human (Homo sapiens) [TaxId:9606] [187221] (293 PDB entries)
  8. 1294465Domain d4h25e2: 4h25 E:93-190 [234613]
    Other proteins in same PDB: d4h25a1, d4h25a2, d4h25b1, d4h25d1, d4h25d2, d4h25e1
    automated match to d4h26e2
    complexed with ipa

Details for d4h25e2

PDB Entry: 4h25 (more details), 2.2 Å

PDB Description: tcr interaction with peptide mimics of nickel offers structure insights to nickel contact allergy
PDB Compounds: (E:) MHC class II antigen

SCOPe Domain Sequences for d4h25e2:

Sequence, based on SEQRES records: (download)

>d4h25e2 b.1.1.2 (E:93-190) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rrvhpqvtvypaktqplqhhnllvcsvsgfypgsievrwfrngqeektgvvstglihngd
wtfqtlvmletvprsgevytcqvehpsvtspltvewra

Sequence, based on observed residues (ATOM records): (download)

>d4h25e2 b.1.1.2 (E:93-190) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rrvhpqvtvypaktnllvcsvsgfypgsievrwfrngqeektgvvstglihngdwtfqtl
vmletvprsgevytcqvehpsvtspltvewra

SCOPe Domain Coordinates for d4h25e2:

Click to download the PDB-style file with coordinates for d4h25e2.
(The format of our PDB-style files is described here.)

Timeline for d4h25e2: