Lineage for d4h25b1 (4h25 B:6-92)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2937552Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2938555Protein automated matches [191280] (6 species)
    not a true protein
  7. 2938568Species Human (Homo sapiens) [TaxId:9606] [189896] (31 PDB entries)
  8. 2938585Domain d4h25b1: 4h25 B:6-92 [234610]
    Other proteins in same PDB: d4h25a1, d4h25a2, d4h25b2, d4h25b3, d4h25b4, d4h25d1, d4h25d2, d4h25e2, d4h25e3, d4h25e4
    automated match to d4h26e1
    complexed with ipa

Details for d4h25b1

PDB Entry: 4h25 (more details), 2.2 Å

PDB Description: tcr interaction with peptide mimics of nickel offers structure insights to nickel contact allergy
PDB Compounds: (B:) MHC class II antigen

SCOPe Domain Sequences for d4h25b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4h25b1 d.19.1.1 (B:6-92) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rflellksechffngtervrfleryfhnqeefvrfdsdvgeyravtelgrpvaeswnsqk
dlleqkrgqvdtycrhnygvvesftvq

SCOPe Domain Coordinates for d4h25b1:

Click to download the PDB-style file with coordinates for d4h25b1.
(The format of our PDB-style files is described here.)

Timeline for d4h25b1: