Lineage for d1ruh3_ (1ruh 3:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily) Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families) 
Family b.10.1.4: Animal virus proteins [49656] (15 proteins) 
Protein Rhinovirus coat protein [49670] (5 species) 
Species Human rhinovirus 14 [TaxId:12131] [49671] (27 PDB entries) 
Domain d1ruh3_: 1ruh 3: [23461]
Details for d1ruh3_
PDB Entry: 1ruh (more details), 3 Å
PDB Description: rhinovirus 14 mutant n1219s complexed with antiviral compound win 52084
SCOP Domain Sequences for d1ruh3_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ruh3_ b.10.1.4 (3:) Rhinovirus coat protein {Human rhinovirus 14}
glptttlpgsgqflttddrqspsalpnyeptprihipgkvhnlleiiqvdtlipmnntht
kdevnsyliplnanrqneqvfgtnlfigdgvfkttllgeivqyythwsgslrfslmytgp
alssaklilaytppgargpqdrreamlgthvvwdiglqstivmtipwtsgvqfrytdpdt
ytsagflscwyqtslilppettgqvyllsfisacpdfklrlmkdtqtisqtvalte
SCOP Domain Coordinates for d1ruh3_:
Click to download the PDB-style file with coordinates for d1ruh3_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ruh3_:
- d1ruh3_ appears in SCOP 1.57
- d1ruh3_ appears in the current release, SCOPe 2.08
View in 3D
