SCOPe 2.03: Domain d4h2hb1: 4h2h B:1-125

Lineage for d4h2hb1 (4h2h B:1-125)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (55 species)
   not a true protein

7. Species Pelagibaca bermudensis [TaxId:314265] [234600] (1 PDB entry)

8. Domain d4h2hb1: 4h2h B:1-125 [234608]
   Other proteins in same PDB: d4h2ha2, d4h2hb2, d4h2hc2
   automated match to d4mggf1
   complexed with 0xw, iod, mg, mpd, ni

Details for d4h2hb1

PDB Entry: 4h2h, 1.7 Å

PDB Description: Crystal structure of an enolase (mandalate racemase subgroup, target EFI-502101) from Pelagibaca bermudensis htcc2601, with bound mg and l-4-hydroxyproline betaine (betonicine)

PDB Compounds: (B:) Mandelate racemase/muconate lactonizing enzyme

SCOPe Domain Sequences for d4h2hb1:

Sequence; same for both SEQRES and ATOM records:

>d4h2hb1 d.54.1.0 (B:1-125) automated matches {Pelagibaca bermudensis [TaxId: 314265]}
lkiaeiqlfqhdlpvvngpyriasgdvwsltttivkiiaedgtigwgetcpvgptyaeah
aggalaalevlasglagaealplplhtrmdsllcghnyaksaldiavhdlwgkrlgvpvh
ellgg

Timeline for d4h2hb1:

• d4h2hb1 is new in SCOPe 2.03-stable
  
• d4h2hb1 appears in SCOPe 2.04
  
• d4h2hb1 appears in the current release, SCOPe 2.08