SCOPe 2.08: Domain d4h0wa2: 4h0w A:335-679

Lineage for d4h0wa2 (4h0w A:335-679)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (161 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [193730] (34 PDB entries)

8. Domain d4h0wa2: 4h0w A:335-679 [234596]
   automated match to d1jnfa2
   complexed with bs3, co3, fe, nag, nta

Details for d4h0wa2

PDB Entry: 4h0w, 2.4 Å

PDB Description: bismuth bound human serum transferrin

PDB Compounds: (A:) serotransferrin

SCOPe Domain Sequences for d4h0wa2:

Sequence; same for both SEQRES and ATOM records:

>d4h0wa2 c.94.1.0 (A:335-679) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ptdeckpvkwcalshherlkcdewsvnsvgkiecvsaettedciakimngeadamsldgg
fvyiagkcglvpvlaenynksdncedtpeagyfaiavvkksasdltwdnlkgkkschtav
grtagwnipmgllynkinhcrfdeffsegcapgskkdsslcklcmgsglnlcepnnkegy
ygytgafrclvekgdvafvkhqtvpqntggknpdpwaknlnekdyellcldgtrkpveey
anchlarapnhavvtrkdkeacvhkilrqqqhlfgsnvtdcsgnfclfrsetkdllfrdd
tvclaklhdrntyekylgeeyvkavgnlrkcstsslleactfrrp

Timeline for d4h0wa2:

• d4h0wa2 first appeared in SCOPe 2.03
  
• d4h0wa2 appears in SCOPe 2.07