Lineage for d4h0xa2 (4h0x A:210-413)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1939878Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 1939879Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 1939880Family d.166.1.1: ADP-ribosylating toxins [56400] (10 proteins)
  6. 1940022Protein automated matches [190133] (5 species)
    not a true protein
  7. 1940073Species Clostridium perfringens [TaxId:1502] [234554] (6 PDB entries)
  8. 1940083Domain d4h0xa2: 4h0x A:210-413 [234592]
    Other proteins in same PDB: d4h0xb1, d4h0xb2
    automated match to d1giqa2
    complexed with atp, ca, edo, lar, nad, po4

Details for d4h0xa2

PDB Entry: 4h0x (more details), 2.33 Å

PDB Description: Crystal structure of NAD+-Ia(E380A)-actin complex
PDB Compounds: (A:) Iota toxin component Ia

SCOPe Domain Sequences for d4h0xa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4h0xa2 d.166.1.1 (A:210-413) automated matches {Clostridium perfringens [TaxId: 1502]}
sldfkddvskgdlwgkenysdwsnkltpneladvndymrggytainnylisngplnnpnp
eldskvnnienalkltpipsnlivyrrsgpqefgltltspeydfnkienidafkekwegk
vitypnfistsigsvnmsafakrkiilrinipkdspgaylsaipgyageyavllnhgskf
kinkvdsykdgtvtklildatlin

SCOPe Domain Coordinates for d4h0xa2:

Click to download the PDB-style file with coordinates for d4h0xa2.
(The format of our PDB-style files is described here.)

Timeline for d4h0xa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4h0xa1