SCOPe 2.07: Domain d4h0xa1: 4h0x A:1-209

Lineage for d4h0xa1 (4h0x A:1-209)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.166: ADP-ribosylation [56398] (1 superfamily)
   unusual fold

4. Superfamily d.166.1: ADP-ribosylation [56399] (8 families)

5. Family d.166.1.1: ADP-ribosylating toxins [56400] (10 proteins)

6. Protein automated matches [190133] (7 species)
   not a true protein

7. Species Clostridium perfringens [TaxId:1502] [234554] (8 PDB entries)

8. Domain d4h0xa1: 4h0x A:1-209 [234591]
   Other proteins in same PDB: d4h0xb1, d4h0xb2
   automated match to d1giqa1
   complexed with atp, ca, edo, lar, nad, po4

Details for d4h0xa1

PDB Entry: 4h0x, 2.33 Å

PDB Description: Crystal structure of NAD+-Ia(E380A)-actin complex

PDB Compounds: (A:) Iota toxin component Ia

SCOPe Domain Sequences for d4h0xa1:

Sequence; same for both SEQRES and ATOM records:

>d4h0xa1 d.166.1.1 (A:1-209) automated matches {Clostridium perfringens [TaxId: 1502]}
afierpedflkdkenaiqwekkeaerveknldtlekealelykkdseqisnysqtrqyfy
dyqiesnprekeyknlrnaisknkidkpinvyyfespekfafnkeirtenqneislekfn
elketiqdklfkqdgfkdvslyepgngdekptpllihlklpkntgmlpyinsndvktlie
qdysikidkivriviegkqyikaeasivn

Timeline for d4h0xa1:

• d4h0xa1 first appeared in SCOPe 2.03
  
• d4h0xa1 appears in SCOPe 2.06
  
• d4h0xa1 appears in the current release, SCOPe 2.08