SCOPe 2.08: Domain d4h0rb_: 4h0r B:

Lineage for d4h0rb_ (4h0r B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families)
   automatically mapped to Pfam PF00303

5. Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)

6. Protein automated matches [190469] (17 species)
   not a true protein

7. Species Corynebacterium glutamicum [TaxId:196627] [227854] (2 PDB entries)

8. Domain d4h0rb_: 4h0r B: [234588]
   automated match to d4h0ra_

Details for d4h0rb_

PDB Entry: 4h0r, 2.3 Å

PDB Description: crystal structure of thymidylate synthase from corynebacterium glutamicum

PDB Compounds: (B:) Thymidylate synthase

SCOPe Domain Sequences for d4h0rb_:

Sequence; same for both SEQRES and ATOM records:

>d4h0rb_ d.117.1.1 (B:) automated matches {Corynebacterium glutamicum [TaxId: 196627]}
mtvptpyedllrkiaeegshkddrtgtgttslfgqqirfdlnegfpllttkkvhfhsvvg
ellwflqgdsnvkwlqdnniriwnewadedgelgpvygvqwrswptpdgrhidqisgale
tlrnnpdsrrnivsawnvselenmalppchllfqlyvadgklscqlyqrsadmflgvpfn
iasyallthmfaqqaglevgefiwtggdchiydnhkeqvaeqlsrearpyptlelnkaas
mfeysfdditvsgydphpli

Timeline for d4h0rb_:

• d4h0rb_ first appeared in SCOPe 2.03
  
• d4h0rb_ appears in SCOPe 2.07