Lineage for d4h0ob1 (4h0o B:2-188)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2883384Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2884835Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 2884836Protein automated matches [226839] (64 species)
    not a true protein
  7. 2885004Species Entamoeba (Entamoeba histolytica) [TaxId:5759] [234583] (1 PDB entry)
  8. 2885007Domain d4h0ob1: 4h0o B:2-188 [234586]
    automated match to d3sk3a1

Details for d4h0ob1

PDB Entry: 4h0o (more details), 2.4 Å

PDB Description: Crystal Structure of Acetate Kinase from Entamoeba histolytica
PDB Compounds: (B:) acetate kinase

SCOPe Domain Sequences for d4h0ob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4h0ob1 c.55.1.0 (B:2-188) automated matches {Entamoeba (Entamoeba histolytica) [TaxId: 5759]}
snvlifnvgsssltykvfcsdnivcsgksnrvnvtgtekpfiehhlngqiikietpilnh
pqaakliiqflkenhisiafvghrfvhggsyfkksavidevvlkelkeclplapihnpss
fgvieismkelpttrqyvaidtafhstisqaertyaipqpyqsqylkfgfhglsyeyvin
slknvid

SCOPe Domain Coordinates for d4h0ob1:

Click to download the PDB-style file with coordinates for d4h0ob1.
(The format of our PDB-style files is described here.)

Timeline for d4h0ob1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4h0ob2