SCOPe 2.03: Domain d4h0oa2: 4h0o A:189-392

Lineage for d4h0oa2 (4h0o A:189-392)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (35 species)
   not a true protein

7. Species Entamoeba histolytica [TaxId:5759] [234583] (1 PDB entry)

8. Domain d4h0oa2: 4h0o A:189-392 [234585]
   automated match to d3sk3a2

Details for d4h0oa2

PDB Entry: 4h0o, 2.4 Å

PDB Description: Crystal Structure of Acetate Kinase from Entamoeba histolytica

PDB Compounds: (A:) acetate kinase

SCOPe Domain Sequences for d4h0oa2:

Sequence; same for both SEQRES and ATOM records:

>d4h0oa2 c.55.1.0 (A:189-392) automated matches {Entamoeba histolytica [TaxId: 5759]}
vshskiiachlgtggssccgivngksfdtsmgnstlaglvmstrcgdidptipidmiqqv
giekvvdilnkksgllgvselssdmrdilheietrgpkaktcqlafdvyikqlaktiggl
mveiggldllvftdqmglevwqvrkaicdkmkflgielddslneksmgkkiefltmpssk
vqvcvapndeelvilqkgkelfqf

Timeline for d4h0oa2:

• d4h0oa2 is new in SCOPe 2.03-stable
  
• d4h0oa2 appears in SCOPe 2.04
  
• d4h0oa2 appears in the current release, SCOPe 2.08