![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily) contains large mixed beta-sheet |
![]() | Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) ![]() |
![]() | Family d.104.1.0: automated matches [227172] (1 protein) not a true family |
![]() | Protein automated matches [226887] (24 species) not a true protein |
![]() | Species Plasmodium falciparum [TaxId:36329] [234567] (7 PDB entries) |
![]() | Domain d4h02c2: 4h02 C:229-583 [234576] Other proteins in same PDB: d4h02a1, d4h02b1, d4h02c1, d4h02d1, d4h02e1, d4h02f1, d4h02g1, d4h02h1 automated match to d4dpgb2 |
PDB Entry: 4h02 (more details), 2.91 Å
SCOPe Domain Sequences for d4h02c2:
Sequence, based on SEQRES records: (download)
>d4h02c2 d.104.1.0 (C:229-583) automated matches {Plasmodium falciparum [TaxId: 36329]} dteiryrqryldllinessrhtfvtrtkiinflrnflnergffevetpmmnliagganar pfithhndldldlylriatelplkmlivggidkvyeigkvfrnegidnthnpeftscefy wayadyndlikwsedffsqlvyhlfgtykisynkdgpenqpieidftppypkvsiveeie kvtntileqpfdsnetiekminiikehkielpnpptaaklldqlashfienkyndkpffi vehpqimsplakyhrtkpglterlemficgkevlnaytelndpfkqkecfklqqkdrekg dteaaqldsafctsleyglpptgglglgidritmfltnknsikdvilfptmrpan
>d4h02c2 d.104.1.0 (C:229-583) automated matches {Plasmodium falciparum [TaxId: 36329]} dteiryrqryldllinessrhtfvtrtkiinflrnflnergffevetpmmnlipfithhn dldldlylriatelplkmlivggidkvyeigkvfrnegidnthnpeftscefywayadyn dlikwsedffsqlvyhlfgtykisynkdgpenqpieidftppypkvsiveeiekvtntil eqpfdsnetiekminiikehkielpnpptaaklldqlashfienkyndkpffivehpqim splakyhrtkpglterlemficgkevlnaytelndpffctsleyglpptgglglgidrit mfltnknsikdvilfptmrpan
Timeline for d4h02c2: