Class b: All beta proteins [48724] (176 folds) |
Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) |
Family b.40.4.0: automated matches [191416] (1 protein) not a true family |
Protein automated matches [190576] (22 species) not a true protein |
Species Plasmodium falciparum [TaxId:36329] [234564] (2 PDB entries) |
Domain d4h02c1: 4h02 C:80-228 [234570] Other proteins in same PDB: d4h02a2, d4h02b2, d4h02c2, d4h02d2, d4h02e2, d4h02f2, d4h02g2, d4h02h2 automated match to d3bjua1 |
PDB Entry: 4h02 (more details), 2.9 Å
SCOPe Domain Sequences for d4h02c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4h02c1 b.40.4.0 (C:80-228) automated matches {Plasmodium falciparum [TaxId: 36329]} prlyfenrskfiqdqkdkginpyphkfertisipefiekykdlgngehledtilnitgri mrvsasgqklrffdlvgdgekiqvlanysfhnhekgnfaecydkirrgdivgivgfpgks kkgelsifpketillsaclhmlpmkyglk
Timeline for d4h02c1: