Lineage for d4h02a2 (4h02 A:229-581)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1920668Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 1920669Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 1921049Family d.104.1.0: automated matches [227172] (1 protein)
    not a true family
  6. 1921050Protein automated matches [226887] (9 species)
    not a true protein
  7. 1921101Species Plasmodium falciparum [TaxId:36329] [234567] (2 PDB entries)
  8. 1921106Domain d4h02a2: 4h02 A:229-581 [234568]
    Other proteins in same PDB: d4h02a1, d4h02b1, d4h02c1, d4h02d1, d4h02e1, d4h02f1, d4h02g1, d4h02h1
    automated match to d4dpgb2

Details for d4h02a2

PDB Entry: 4h02 (more details), 2.9 Å

PDB Description: crystal structure of p. falciparum lysyl-trna synthetase
PDB Compounds: (A:) lysyl-tRNA synthetase

SCOPe Domain Sequences for d4h02a2:

Sequence, based on SEQRES records: (download)

>d4h02a2 d.104.1.0 (A:229-581) automated matches {Plasmodium falciparum [TaxId: 36329]}
dteiryrqryldllinessrhtfvtrtkiinflrnflnergffevetpmmnliagganar
pfithhndldldlylriatelplkmlivggidkvyeigkvfrnegidnthnpeftscefy
wayadyndlikwsedffsqlvyhlfgtykisynkdgpenqpieidftppypkvsiveeie
kvtntileqpfdsnetiekminiikehkielpnpptaaklldqlashfienkyndkpffi
vehpqimsplakyhrtkpglterlemficgkevlnaytelndpfkqkecfklqqkdrekg
dteaaqldsafctsleyglpptgglglgidritmfltnknsikdvilfptmrp

Sequence, based on observed residues (ATOM records): (download)

>d4h02a2 d.104.1.0 (A:229-581) automated matches {Plasmodium falciparum [TaxId: 36329]}
dteiryrqryldllinessrhtfvtrtkiinflrnflnergffevetpmmnlipfithhn
dldldlylriatelplkmlivggidkvyeigkvfrnegidnthnpeftscefywayadyn
dlikwsedffsqlvyhlfgtykisynkdgpenqpieidftppypkvsiveeiekvtntil
eqpfdsnetiekminiikehkielpnpptaaklldqlashfienkyndkpffivehpqim
splakyhrtkpglterlemficgkevlnaytelndpffctsleyglpptgglglgidrit
mfltnknsikdvilfptmrp

SCOPe Domain Coordinates for d4h02a2:

Click to download the PDB-style file with coordinates for d4h02a2.
(The format of our PDB-style files is described here.)

Timeline for d4h02a2: