SCOPe 2.03: Domain d4h02a1: 4h02 A:80-228

Lineage for d4h02a1 (4h02 A:80-228)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families)

5. Family b.40.4.0: automated matches [191416] (1 protein)
   not a true family

6. Protein automated matches [190576] (18 species)
   not a true protein

7. Species Plasmodium falciparum [TaxId:36329] [234564] (1 PDB entry)

8. Domain d4h02a1: 4h02 A:80-228 [234565]
   Other proteins in same PDB: d4h02a2, d4h02b2, d4h02c2, d4h02d2, d4h02e2, d4h02f2, d4h02g2, d4h02h2
   automated match to d3bjua1

Details for d4h02a1

PDB Entry: 4h02, 2.9 Å

PDB Description: crystal structure of p. falciparum lysyl-trna synthetase

PDB Compounds: (A:) lysyl-tRNA synthetase

SCOPe Domain Sequences for d4h02a1:

Sequence; same for both SEQRES and ATOM records:

>d4h02a1 b.40.4.0 (A:80-228) automated matches {Plasmodium falciparum [TaxId: 36329]}
prlyfenrskfiqdqkdkginpyphkfertisipefiekykdlgngehledtilnitgri
mrvsasgqklrffdlvgdgekiqvlanysfhnhekgnfaecydkirrgdivgivgfpgks
kkgelsifpketillsaclhmlpmkyglk

Timeline for d4h02a1:

• d4h02a1 is new in SCOPe 2.03-stable
  
• d4h02a1 appears in SCOPe 2.04
  
• d4h02a1 appears in the current release, SCOPe 2.08