Class a: All alpha proteins [46456] (286 folds) |
Fold a.87: DBL homology domain (DH-domain) [48064] (1 superfamily) multihelical; core: 5-helical bundle |
Superfamily a.87.1: DBL homology domain (DH-domain) [48065] (2 families) automatically mapped to Pfam PF00621 |
Family a.87.1.0: automated matches [233075] (1 protein) not a true family |
Protein automated matches [233076] (2 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [234557] (1 PDB entry) |
Domain d4gyva_: 4gyv A: [234562] automated match to d1by1a_ |
PDB Entry: 4gyv (more details), 2.9 Å
SCOPe Domain Sequences for d4gyva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4gyva_ a.87.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} gphmedeayfiakeilatertylkdlevitvwfrsvlikeeampaalmallfsnidpvye fhrgflheveqrlalwegpssahlkgdhqrigdillrnmrqlkeftsyfqrhdevltele katkhckkleavykefelqkvcylplntfllkpvqrlvhyrlllsrlcahyspghrdyad chealkaitevttelqqsltrlenlqkltelqrdlv
Timeline for d4gyva_: