![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.87: DBL homology domain (DH-domain) [48064] (1 superfamily) multihelical; core: 5-helical bundle |
![]() | Superfamily a.87.1: DBL homology domain (DH-domain) [48065] (2 families) ![]() automatically mapped to Pfam PF00621 |
![]() | Family a.87.1.0: automated matches [233075] (1 protein) not a true family |
![]() | Protein automated matches [233076] (2 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [234557] (1 PDB entry) |
![]() | Domain d4gyvc1: 4gyv C:536-747 [234561] Other proteins in same PDB: d4gyva2, d4gyvb2, d4gyvc2, d4gyvd2, d4gyve2, d4gyvf2, d4gyvg2, d4gyvh2, d4gyvi2 automated match to d1by1a_ |
PDB Entry: 4gyv (more details), 2.9 Å
SCOPe Domain Sequences for d4gyvc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4gyvc1 a.87.1.0 (C:536-747) automated matches {Mouse (Mus musculus) [TaxId: 10090]} edeayfiakeilatertylkdlevitvwfrsvlikeeampaalmallfsnidpvyefhrg flheveqrlalwegpssahlkgdhqrigdillrnmrqlkeftsyfqrhdevltelekatk hckkleavykefelqkvcylplntfllkpvqrlvhyrlllsrlcahyspghrdyadchea lkaitevttelqqsltrlenlqkltelqrdlv
Timeline for d4gyvc1: