Lineage for d4gyvc1 (4gyv C:536-747)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719559Fold a.87: DBL homology domain (DH-domain) [48064] (1 superfamily)
    multihelical; core: 5-helical bundle
  4. 2719560Superfamily a.87.1: DBL homology domain (DH-domain) [48065] (2 families) (S)
    automatically mapped to Pfam PF00621
  5. 2719629Family a.87.1.0: automated matches [233075] (1 protein)
    not a true family
  6. 2719630Protein automated matches [233076] (2 species)
    not a true protein
  7. 2719636Species Mouse (Mus musculus) [TaxId:10090] [234557] (1 PDB entry)
  8. 2719639Domain d4gyvc1: 4gyv C:536-747 [234561]
    Other proteins in same PDB: d4gyva2, d4gyvb2, d4gyvc2, d4gyvd2, d4gyve2, d4gyvf2, d4gyvg2, d4gyvh2, d4gyvi2
    automated match to d1by1a_

Details for d4gyvc1

PDB Entry: 4gyv (more details), 2.9 Å

PDB Description: crystal structure of the dh domain of farp2
PDB Compounds: (C:) FERM, RhoGEF and pleckstrin domain-containing protein 2

SCOPe Domain Sequences for d4gyvc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gyvc1 a.87.1.0 (C:536-747) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
edeayfiakeilatertylkdlevitvwfrsvlikeeampaalmallfsnidpvyefhrg
flheveqrlalwegpssahlkgdhqrigdillrnmrqlkeftsyfqrhdevltelekatk
hckkleavykefelqkvcylplntfllkpvqrlvhyrlllsrlcahyspghrdyadchea
lkaitevttelqqsltrlenlqkltelqrdlv

SCOPe Domain Coordinates for d4gyvc1:

Click to download the PDB-style file with coordinates for d4gyvc1.
(The format of our PDB-style files is described here.)

Timeline for d4gyvc1: