SCOPe 2.05: Domain d4gwxa_: 4gwx A:

Lineage for d4gwxa_ (4gwx A:)

1. Root: SCOPe 2.05

2. Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)

3. Fold e.7: Carbohydrate phosphatase [56654] (1 superfamily)
   N-terminal domain is an alpha+beta, C-terminal domain is an alpha/beta with mixed beta-sheet

4. Superfamily e.7.1: Carbohydrate phosphatase [56655] (3 families)

5. Family e.7.1.1: Inositol monophosphatase/fructose-1,6-bisphosphatase-like [56656] (7 proteins)

6. Protein Fructose-1,6-bisphosphatase [56657] (7 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [56658] (65 PDB entries)

8. Domain d4gwxa_: 4gwx A: [234548]
   automated match to d4gwza_
   complexed with f6p, mg, po4

Details for d4gwxa_

PDB Entry: 4gwx, 2.35 Å

PDB Description: crystal structure of product complexes of porcine liver fructose-1,6- bisphosphatase with restrained subunit pair rotation

PDB Compounds: (A:) Fructose-1,6-bisphosphatase 1

SCOPe Domain Sequences for d4gwxa_:

Sequence; same for both SEQRES and ATOM records:

>d4gwxa_ e.7.1.1 (A:) Fructose-1,6-bisphosphatase {Pig (Sus scrofa) [TaxId: 9823]}
dtnivtltrfvweegrkargtgemtqllnslctavkaistavrkagiahlygiagstnvt
gdqvkkldvlsndlvinvlkssfatcvlvseedknaiivepekrgkyvvcfdpldgssni
dclvsigtifgiyrknstdepsekdalqpgrnlvaagyalygsatmlvlamvngvncfml
dpaigefilvdrdvkikkkgsiysinegyakefdpaiteyiqrkkfppdnsapygaryvg
smvadvhrtlvyggifmypankkspkgklrllyecnpmayvmekagglattgkeavldiv
ptdihqrapiilgspedvtelleiyqkha

Timeline for d4gwxa_:

• d4gwxa_ first appeared in SCOPe 2.03
  
• d4gwxa_ appears in SCOPe 2.04
  
• d4gwxa_ appears in SCOPe 2.06
  
• d4gwxa_ appears in the current release, SCOPe 2.08