Lineage for d4gw3a_ (4gw3 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2135238Family c.69.1.18: Bacterial lipase [53570] (4 protein domains)
    lack the first two strands of the common fold
  6. 2135259Protein Lipase A [64145] (3 species)
    minimal alpha/beta hydrolase fold;
  7. 2135308Species Proteus mirabilis [TaxId:584] [224908] (3 PDB entries)
  8. 2135310Domain d4gw3a_: 4gw3 A: [234540]
    automated match to d4gxna_
    complexed with 1pe, ca, gol, ipa

Details for d4gw3a_

PDB Entry: 4gw3 (more details), 2 Å

PDB Description: Crystal Structure of the Lipase from Proteus mirabilis
PDB Compounds: (A:) Putative lipase

SCOPe Domain Sequences for d4gw3a_:

Sequence, based on SEQRES records: (download)

>d4gw3a_ c.69.1.18 (A:) Lipase A {Proteus mirabilis [TaxId: 584]}
stkypivlvhglagfneivgfpyfygiadalrqdghqvftaslsafnsnevrgkqlwqfv
qtllqetqakkvnfighsqgplacryvaanypdsvasvtsingvnhgseiadlyrrimrk
dsipeyivekvlnafgtiistfsghrgdpqdaiaalesltteqvtefnnkypqalpktpg
gegdeivngvhyycfgsyiqgliagekgnlldpthaamrvlntfftekqndglvgrssmr
lgklikddyaqdhidmvnqvaglvgynedivaiytqhakylaskql

Sequence, based on observed residues (ATOM records): (download)

>d4gw3a_ c.69.1.18 (A:) Lipase A {Proteus mirabilis [TaxId: 584]}
stkypivlvhglagfneivgfpyfygiadalrqdghqvftaslsafnsnevrgkqlwqfv
qtllqetqakkvnfighsqgplacryvaanypdsvasvtsingvnhgseiadlyrrimrk
dsipeyivekvlnafgtiistfsghdpqdaiaalesltteqvtefnnkypqalpktpgge
gdeivngvhyycfgsyiqgliagekgnlldpthaamrvlntfftekqndglvgrssmrlg
klikddyaqdhidmvnqvaglvgynedivaiytqhakylaskql

SCOPe Domain Coordinates for d4gw3a_:

Click to download the PDB-style file with coordinates for d4gw3a_.
(The format of our PDB-style files is described here.)

Timeline for d4gw3a_: