![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
![]() | Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) ![]() many members have left-handed crossover connection between strand 8 and additional strand 9 |
![]() | Family c.69.1.18: Bacterial lipase [53570] (4 proteins) lack the first two strands of the common fold |
![]() | Protein Lipase A [64145] (4 species) minimal alpha/beta hydrolase fold; |
![]() | Species Proteus mirabilis [TaxId:584] [224908] (4 PDB entries) |
![]() | Domain d4gw3a_: 4gw3 A: [234540] automated match to d4gxna_ complexed with 1pe, ca, gol, ipa has additional insertions and/or extensions that are not grouped together |
PDB Entry: 4gw3 (more details), 2 Å
SCOPe Domain Sequences for d4gw3a_:
Sequence, based on SEQRES records: (download)
>d4gw3a_ c.69.1.18 (A:) Lipase A {Proteus mirabilis [TaxId: 584]} stkypivlvhglagfneivgfpyfygiadalrqdghqvftaslsafnsnevrgkqlwqfv qtllqetqakkvnfighsqgplacryvaanypdsvasvtsingvnhgseiadlyrrimrk dsipeyivekvlnafgtiistfsghrgdpqdaiaalesltteqvtefnnkypqalpktpg gegdeivngvhyycfgsyiqgliagekgnlldpthaamrvlntfftekqndglvgrssmr lgklikddyaqdhidmvnqvaglvgynedivaiytqhakylaskql
>d4gw3a_ c.69.1.18 (A:) Lipase A {Proteus mirabilis [TaxId: 584]} stkypivlvhglagfneivgfpyfygiadalrqdghqvftaslsafnsnevrgkqlwqfv qtllqetqakkvnfighsqgplacryvaanypdsvasvtsingvnhgseiadlyrrimrk dsipeyivekvlnafgtiistfsghdpqdaiaalesltteqvtefnnkypqalpktpgge gdeivngvhyycfgsyiqgliagekgnlldpthaamrvlntfftekqndglvgrssmrlg klikddyaqdhidmvnqvaglvgynedivaiytqhakylaskql
Timeline for d4gw3a_: