Lineage for d4gunl2 (4gun L:90-206)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2946001Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 2946002Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 2946299Family d.44.1.0: automated matches [227155] (1 protein)
    not a true family
  6. 2946300Protein automated matches [226860] (38 species)
    not a true protein
  7. 2946572Species Yeast (Candida albicans) [TaxId:5476] [226298] (2 PDB entries)
  8. 2946584Domain d4gunl2: 4gun L:90-206 [234527]
    Other proteins in same PDB: d4guna1, d4gunb1, d4gunc1, d4gund1, d4gune1, d4gunf1, d4gung1, d4gunh1, d4guni1, d4gunj1, d4gunk1, d4gunl1, d4gunm1, d4gunn1, d4guno1, d4gunp1
    automated match to d4gune2
    complexed with mn, so4; mutant

Details for d4gunl2

PDB Entry: 4gun (more details), 1.94 Å

PDB Description: Crystal Structure of the K184R, L185P mutant manganese superoxide dismutase from Candida albicans cytosol
PDB Compounds: (L:) superoxide dismutase

SCOPe Domain Sequences for d4gunl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gunl2 d.44.1.0 (L:90-206) automated matches {Yeast (Candida albicans) [TaxId: 5476]}
vskgggkhpdtssalgkqivaqygsvsnliditnsklagiqgsgwafivknkqnggaldv
vttanqdtisaphlvpiiaidawehayylqyqnvrpdyfkaiwnvinwaeaesrysa

SCOPe Domain Coordinates for d4gunl2:

Click to download the PDB-style file with coordinates for d4gunl2.
(The format of our PDB-style files is described here.)

Timeline for d4gunl2: