Lineage for d4gunh1 (4gun H:2-89)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2689745Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 2690049Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) (S)
    automatically mapped to Pfam PF00081
  5. 2690339Family a.2.11.0: automated matches [227154] (1 protein)
    not a true family
  6. 2690340Protein automated matches [226859] (39 species)
    not a true protein
  7. 2690619Species Yeast (Candida albicans) [TaxId:5476] [226297] (2 PDB entries)
  8. 2690627Domain d4gunh1: 4gun H:2-89 [234518]
    Other proteins in same PDB: d4guna2, d4gunb2, d4gunc2, d4gund2, d4gune2, d4gunf2, d4gung2, d4gunh2, d4guni2, d4gunj2, d4gunk2, d4gunl2, d4gunm2, d4gunn2, d4guno2, d4gunp2
    automated match to d4gune1
    complexed with mn, so4; mutant

Details for d4gunh1

PDB Entry: 4gun (more details), 1.94 Å

PDB Description: Crystal Structure of the K184R, L185P mutant manganese superoxide dismutase from Candida albicans cytosol
PDB Compounds: (H:) superoxide dismutase

SCOPe Domain Sequences for d4gunh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gunh1 a.2.11.0 (H:2-89) automated matches {Yeast (Candida albicans) [TaxId: 5476]}
itenekislpkidwaldalepyiskeindlhinkhhvayvngynaaidalekavgkrdlk
svveiqqnikfhggghtnhslfwknlap

SCOPe Domain Coordinates for d4gunh1:

Click to download the PDB-style file with coordinates for d4gunh1.
(The format of our PDB-style files is described here.)

Timeline for d4gunh1: