SCOPe 2.05: Domain d4grlb2: 4grl B:95-191

Lineage for d4grlb2 (4grl B:95-191)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (409 PDB entries)

8. Domain d4grlb2: 4grl B:95-191 [234511]
   Other proteins in same PDB: d4grla1, d4grlb1, d4grlc1
   automated match to d4mayb2
   complexed with nag

Details for d4grlb2

PDB Entry: 4grl, 2.86 Å

PDB Description: crystal structure of a autoimmune tcr-mhc complex

PDB Compounds: (B:) MHC class II antigen

SCOPe Domain Sequences for d4grlb2:

Sequence, based on SEQRES records:

>d4grlb2 b.1.1.2 (B:95-191) automated matches {Human (Homo sapiens) [TaxId: 9606]}
veptvtispsrtealnhhnllicsvtdfypsqikvrwfrndqeetagvvstplirngdwt
fqilvmlemtpqrgdvytchvehpslqspitvewraq

Sequence, based on observed residues (ATOM records):

>d4grlb2 b.1.1.2 (B:95-191) automated matches {Human (Homo sapiens) [TaxId: 9606]}
veptvtispsnllicsvtdfypsqikvrwfrndqeetagvvstplirngdwtfqilvmle
mtpqrgdvytchvehpslqspitvewraq

Timeline for d4grlb2:

• d4grlb2 first appeared in SCOPe 2.03
  
• d4grlb2 appears in SCOPe 2.04
  
• d4grlb2 appears in SCOPe 2.06
  
• d4grlb2 appears in the current release, SCOPe 2.08