![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein automated matches [190374] (15 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries) |
![]() | Domain d4grlb2: 4grl B:95-191 [234511] Other proteins in same PDB: d4grla1, d4grlb1, d4grlc1 automated match to d4mayb2 complexed with nag |
PDB Entry: 4grl (more details), 2.86 Å
SCOPe Domain Sequences for d4grlb2:
Sequence, based on SEQRES records: (download)
>d4grlb2 b.1.1.2 (B:95-191) automated matches {Human (Homo sapiens) [TaxId: 9606]} veptvtispsrtealnhhnllicsvtdfypsqikvrwfrndqeetagvvstplirngdwt fqilvmlemtpqrgdvytchvehpslqspitvewraq
>d4grlb2 b.1.1.2 (B:95-191) automated matches {Human (Homo sapiens) [TaxId: 9606]} veptvtispsnllicsvtdfypsqikvrwfrndqeetagvvstplirngdwtfqilvmle mtpqrgdvytchvehpslqspitvewraq
Timeline for d4grlb2:
![]() Domains from other chains: (mouse over for more information) d4grla1, d4grla2, d4grlc1, d4grlc2 |