SCOPe 2.07: Domain d4grlb1: 4grl B:3-94

Lineage for d4grlb1 (4grl B:3-94)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein automated matches [191280] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189896] (33 PDB entries)

8. Domain d4grlb1: 4grl B:3-94 [234510]
   Other proteins in same PDB: d4grla2, d4grlb2, d4grlc1, d4grlc2
   automated match to d4mayb1
   complexed with nag

Details for d4grlb1

PDB Entry: 4grl, 2.86 Å

PDB Description: crystal structure of a autoimmune tcr-mhc complex

PDB Compounds: (B:) MHC class II antigen

SCOPe Domain Sequences for d4grlb1:

Sequence; same for both SEQRES and ATOM records:

>d4grlb1 d.19.1.1 (B:3-94) automated matches {Human (Homo sapiens) [TaxId: 9606]}
spedfvyqfkglcyftngtervrgvtrhiynreeyvrfdsdvgvyravtpqgrpvaeywn
sqkevlegarasvdrvcrhnyevayrgilqrr

Timeline for d4grlb1:

• d4grlb1 first appeared in SCOPe 2.03
  
• d4grlb1 appears in SCOPe 2.06
  
• d4grlb1 appears in the current release, SCOPe 2.08