SCOPe 2.03: Domain d4grlc2: 4grl C:114-192

Lineage for d4grlc2 (4grl C:114-192)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (12 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (293 PDB entries)

8. Domain d4grlc2: 4grl C:114-192 [234505]
   Other proteins in same PDB: d4grla1, d4grlb1, d4grlc1
   automated match to d4mayc2
   complexed with nag

Details for d4grlc2

PDB Entry: 4grl, 2.86 Å

PDB Description: crystal structure of a autoimmune tcr-mhc complex

PDB Compounds: (C:) TCR Hy.1B11 alpha chain

SCOPe Domain Sequences for d4grlc2:

Sequence; same for both SEQRES and ATOM records:

>d4grlc2 b.1.1.2 (C:114-192) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnns

Timeline for d4grlc2:

• d4grlc2 is new in SCOPe 2.03-stable
  
• d4grlc2 appears in SCOPe 2.04
  
• d4grlc2 appears in the current release, SCOPe 2.08