Lineage for d4groc_ (4gro C:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1421487Fold d.80: Tautomerase/MIF [55330] (1 superfamily)
    (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet
    generally forms trimers with three closely packed beta-sheets
  4. 1421488Superfamily d.80.1: Tautomerase/MIF [55331] (7 families) (S)
  5. 1421611Family d.80.1.3: MIF-related [55339] (3 proteins)
    automatically mapped to Pfam PF01187
  6. 1421620Protein Microphage migration inhibition factor (MIF) [55340] (7 species)
    synonym: glycosylation-inhibiting factor (GIF)
  7. 1421626Species Human (Homo sapiens) [TaxId:9606] [55341] (46 PDB entries)
  8. 1421725Domain d4groc_: 4gro C: [234498]
    automated match to d4grod_
    complexed with cl; mutant

Details for d4groc_

PDB Entry: 4gro (more details), 2 Å

PDB Description: crystallographic and biological characterization of n- and c- terminus mutants of human mif
PDB Compounds: (C:) macrophage migration inhibitory factor

SCOPe Domain Sequences for d4groc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4groc_ d.80.1.3 (C:) Microphage migration inhibition factor (MIF) {Human (Homo sapiens) [TaxId: 9606]}
paaamfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepca
lcslhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfa

SCOPe Domain Coordinates for d4groc_:

Click to download the PDB-style file with coordinates for d4groc_.
(The format of our PDB-style files is described here.)

Timeline for d4groc_: