SCOPe 2.05: Domain d4gr7a_: 4gr7 A:

Lineage for d4gr7a_ (4gr7 A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key
   duplication: has internal pseudo twofold symmetry

4. Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families)

5. Family b.11.1.0: automated matches [191607] (1 protein)
   not a true family

6. Protein automated matches [191109] (10 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [230909] (9 PDB entries)

8. Domain d4gr7a_: 4gr7 A: [234493]
   automated match to d1bd7a_
   complexed with po4; mutant

Details for d4gr7a_

PDB Entry: 4gr7, 1.7 Å

PDB Description: The human W42R Gamma D-Crystallin Mutant Structure at 1.7A Resolution

PDB Compounds: (A:) Gamma-crystallin D

SCOPe Domain Sequences for d4gr7a_:

Sequence; same for both SEQRES and ATOM records:

>d4gr7a_ b.11.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gkitlyedrgfqgrhyecssdhpnlqpylsrcnsarvdsgcrmlyeqpnysglqyflrrg
dyadhqqwmglsdsvrscrliphsgshrirlyeredyrgqmieftedcsclqdrfrfnei
hslnvlegswvlyelsnyrgrqyllmpgdyrryqdwgatnarvgslrrvidfs

Timeline for d4gr7a_:

• d4gr7a_ first appeared in SCOPe 2.03
  
• d4gr7a_ appears in SCOPe 2.04
  
• d4gr7a_ appears in SCOPe 2.06
  
• d4gr7a_ appears in the current release, SCOPe 2.08