Lineage for d4gr7a_ (4gr7 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2773464Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
    duplication: has internal pseudo twofold symmetry
  4. 2773465Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families) (S)
  5. 2773616Family b.11.1.0: automated matches [191607] (1 protein)
    not a true family
  6. 2773617Protein automated matches [191109] (11 species)
    not a true protein
  7. 2773666Species Human (Homo sapiens) [TaxId:9606] [230909] (14 PDB entries)
  8. 2773674Domain d4gr7a_: 4gr7 A: [234493]
    automated match to d1bd7a_
    complexed with po4; mutant

Details for d4gr7a_

PDB Entry: 4gr7 (more details), 1.7 Å

PDB Description: The human W42R Gamma D-Crystallin Mutant Structure at 1.7A Resolution
PDB Compounds: (A:) Gamma-crystallin D

SCOPe Domain Sequences for d4gr7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gr7a_ b.11.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gkitlyedrgfqgrhyecssdhpnlqpylsrcnsarvdsgcrmlyeqpnysglqyflrrg
dyadhqqwmglsdsvrscrliphsgshrirlyeredyrgqmieftedcsclqdrfrfnei
hslnvlegswvlyelsnyrgrqyllmpgdyrryqdwgatnarvgslrrvidfs

SCOPe Domain Coordinates for d4gr7a_:

Click to download the PDB-style file with coordinates for d4gr7a_.
(The format of our PDB-style files is described here.)

Timeline for d4gr7a_: